*Target (protein/gene name): fructose-1,6-bisphosphate aldolase *NCBI Gene # or RefSeq#: *Protein ID (NP or XP #) or Wolbachia#: *Organism:Plasmodium falciparum Etiologic Risk Group (see link below): *Background/Disease Information: P. falciparum is a protozoan parasite that is instrumental in causing malaria - the number one most fatal disease in the world. The fructose-1,6-bisphosphate aldolase enzyme is a glycolytic enzyme which if targeted, could halt the production of ATP for the protozoan which would effectively kill it. The p. falciparum version of the enzyme also differs from the human version of the enzyme making selective targeting possible. Essentiality of this protein: Affects glycolysis so it is very essential to p. falciparum survivial (link to article: http://www.ncbi.nlm.nih.gov/pubmed/9521758) Complex of enzymes: no *EC#: 4.1.2.13 Link to BRENDA EC# page:http://www.brenda-enzymes.info/php/result_flat.php4?ecno=4.1.2.13 --Show screenshot of BRENDA enzyme mechanism schematic Enzyme Assay information (spectrophotometric, coupled assay ?, reagents): -- link to Sigma (or other company) page for assay or assay reagents (substrates) -- link to paper that contains assay information -- List cost and quantity of substrate reagents and supplier Structure Available (PDB or Homology model) -- PDB # or closest PDB entry if using homology model: Direct match-http://www.pdb.org/pdb/explore/explore.do?structureId=1A5C -- Query Coverage (if not direct match): N/A -- Max Ident (if not direct match): N/A Druggable Target (see Databases for this): Current Inhibitors: Expression Information (has it been expressed in bacterial cells): expressed in E. coli Purification Method: Image of protein (PyMol or etc):
*length of your protein in Amino Acids = 369 AA Molecular Weight of your protein in kiloDaltons using the Expasy ProtParamwebsite = 40105.0 kDa
Molar Extinction coefficient of your protein at 280 nm wavelength: 39880
*CDS Gene Sequence: *GC% Content for gene: *CDS Gene Sequence (codon optimized) - copy from output of Primer Design Protocol: *GC% Content for gene (codon optimized):
Primer design results for pNIC-Bsa4 cloning (list seqeunces of all of your ~40 nt long primers): (link to DNA Works output text file - that should be saved in your Google Docs folder after you did the primer design protocol)
-- Ask a mentor, Dr. B, or a fellow researcher -how to link a GDocs file if you are not sure how to.
Primer design results for 'tail' primers (this is just 2 sequences):
*NCBI Gene # or RefSeq#:
*Protein ID (NP or XP #) or Wolbachia#:
*Organism: Plasmodium falciparum
Etiologic Risk Group (see link below):
*Background/Disease Information: P. falciparum is a protozoan parasite that is instrumental in causing malaria - the number one most fatal disease in the world. The fructose-1,6-bisphosphate aldolase enzyme is a glycolytic enzyme which if targeted, could halt the production of ATP for the protozoan which would effectively kill it. The p. falciparum version of the enzyme also differs from the human version of the enzyme making selective targeting possible.
Essentiality of this protein: Affects glycolysis so it is very essential to p. falciparum survivial (link to article: http://www.ncbi.nlm.nih.gov/pubmed/9521758)
Complex of enzymes: no
*EC#: 4.1.2.13
Link to BRENDA EC# page: http://www.brenda-enzymes.info/php/result_flat.php4?ecno=4.1.2.13
-- Show screenshot of BRENDA enzyme mechanism schematic
Enzyme Assay information (spectrophotometric, coupled assay ?, reagents):
-- link to Sigma (or other company) page for assay or assay reagents (substrates)
-- link to paper that contains assay information
-- List cost and quantity of substrate reagents and supplier
Structure Available (PDB or Homology model)
-- PDB # or closest PDB entry if using homology model: Direct match-http://www.pdb.org/pdb/explore/explore.do?structureId=1A5C
-- Query Coverage (if not direct match): N/A
-- Max Ident (if not direct match): N/A
Druggable Target (see Databases for this):
Current Inhibitors:
Expression Information (has it been expressed in bacterial cells): expressed in E. coli
Purification Method:
Image of protein (PyMol or etc):
*Amino Acid Sequence:
MAHCTEYMNAPKKLPADVAEELATTAQKLVQAGKGILAADESTQTIKKRFDNIKLENTIE NRASYRDLLFGTKGLGKFISGAILFEETLFQKNEAGVPMVNLLHNENIIPGIKVDKGLVN IPCTDEEKSTQGLDGLAERCKEYYKAGARFAKWRTVLVIDTAKGKPTDLSIHETAWGLAR YASICQQNRLVPIVEPEILADGPHSIEVCAVVTQKVLSCVFKALQENGVLLEGALLKPNM VTAGYECTAKTTTQDVGFLTVRTLRRTVPPALPGVVFLSGGQSEEEASVNLNSINALGPH PWALTFSYGRALQASVLNTWQGKKENVAKAREVLLQRAEANSLATYGKYKGGAGGENAGA SLYEKKYVY
*length of your protein in Amino Acids = 369 AA
Molecular Weight of your protein in kiloDaltons using the Expasy ProtParamwebsite = 40105.0 kDa
Molar Extinction coefficient of your protein at 280 nm wavelength: 39880
*CDS Gene Sequence:
*GC% Content for gene:
*CDS Gene Sequence (codon optimized) - copy from output of Primer Design Protocol:
*GC% Content for gene (codon optimized):
Primer design results for pNIC-Bsa4 cloning (list seqeunces of all of your ~40 nt long primers):
(link to DNA Works output text file - that should be saved in your Google Docs folder after you did the primer design protocol)
-- Ask a mentor, Dr. B, or a fellow researcher -how to link a GDocs file if you are not sure how to.
Primer design results for 'tail' primers (this is just 2 sequences):